Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 688 (Olfr688)

This Recombinant Mouse Olfactory receptor 688 (Olfr688) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 688

UniProt

Q6W049

Expression Region

1-321

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTALHETNSSEVHVSEFILLGFPGIHEFQIWLSLPMALLYIVALGANLLILITIYLEPT LHQPMYQFLGILAAVDIGLATTSMPKILAILWFDAKTISLPECFAQIYAIHTFMCMESGV FLCMAIDRYVAICYPLQYPSIVTEAFVIKATLSMLLRNGLLTIPVPVLAAQRQYCSRNEI DHCLCSNLGVISLACDDITVNRFYQLALAWLVVGSDMILVYASYALIIRSVLRLNSTEAA SKALSTCSSHLILIMFYYTAIVIVSVTHLAGRRVPLIPVLLNVMHIVIPPSLNPVVYALR TQELKVGFRKVFSLSEFVSRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRacle™ rno-miR-3549 miRNA Agomir/Antagomir
AM4740 2 OD, 4 OD, 50 OD

MIRacle™ rno-miR-3549 miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Rasa2 (NM_053268) Mouse Untagged Clone
MC222069 10 µg

Rasa2 (NM_053268) Mouse Untagged Clone

Sign In for Pricing
View Details
CD172a/SIRPA Mouse Monoclonal Antibody (PE)
orb2970712-01 50 Tests

CD172a/SIRPA Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
CD172a/SIRPA Mouse Monoclonal Antibody (PE)
orb2970712-02 100 Tests

CD172a/SIRPA Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
PMN-KETELVOEDINGSWA.-GR4-RLL090 Pipe Markers for Water
268492 220 Roll (220 Marker (s) x 1 Roll)

PMN-KETELVOEDINGSWA.-GR4-RLL090 Pipe Markers for Water

Sign In for Pricing
View Details
HNF1A Antibody
MBS9607829-01 0.1 mL

HNF1A Antibody

Sign In for Pricing
View Details