Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6K2 (OR6K2)

This Recombinant Human Olfactory receptor 6K2 (OR6K2) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 6K2, Olfactory receptor OR1-17

UniProt

Q8NGY2

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESPNRTTIQEFIFSAFPYSWVKSVVCFVPLLFIYAFIVVGNLVIITVVQLNTHLHTPMY TFISALSFLEIWYTTATIPKMLSSLLSERSISFNGCLLQMYFFHSTGICEVCLLTVMAFD HYLAICSPLHYPSIMTPKLCTQLTLSCCVCGFITPLPEIAWISTLPFCGSNHLEHIFCDF LPVLRLACTDTRAIVMIQVVDVIHAVEIITAVMLIFMSYDGIVAVILRIHSAGGRRTAFS TCVSHFIVFSLFFGSVTLMYLRFSATYSLFWDIAIALAFAVLSPFFNPIIYSLRNKEIKE AIKKHIGQAKIFFSVRPGTSSKIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (Membrane Metalloendopeptidase) (MME/1620), CF405S conjugate, 0.1mg/mL
BNC041620-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB523680 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
FOXO1 Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF810653 100 µg

FOXO1 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

Sign In for Pricing
View Details
(aR,bS)-Bedaquiline
TRC-B119535-50MG 50 mg

(aR,bS)-Bedaquiline

Sign In for Pricing
View Details
ApoER2 (LRP8) (C-term) Rabbit Polyclonal Antibody
AP13124PU-N 400 µL

ApoER2 (LRP8) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CCL3 / MIP-1 alpha Recombinant Rabbit monoclonal Antibody
HA723377 100 µL

Human CCL3 / MIP-1 alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details