Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-30 (srd-30)

This Recombinant Serpentine receptor class delta-30 (srd-30) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-30, Protein srd-30

UniProt

P91209

Expression Region

1-324

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYQIIHSVLSTVGVSLNAFMMYLALTKSPKIMRPCSAIITIKTGTDILASIMSFFVMQR VITDGSSIIVIPTGPCTNFGKTACYVGHMLMLCFLEYNLIWMISSYIFRYYILYVRDPPI KHLVFVAFCLSIPSMVHMAAWFSFYDSNETTEDLSSYGIGSGEMALGGEVVYWSAITLIT QLFITAFLVVVAYIWIRETLCSFAVKMGSVKKDVKNLNKRLVKVINFQVFLPSFIFLGVI TFASMFTSKISYEYAQYAISVIFMFSPICSPFSYILFVPHYRNVIIGKKKQPKPHPEMCG PIRSNTRTTSISVTNNSSHLSSAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tannic Acid
TRC-T006560-25G 25 g

Tannic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS706879 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR561803 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
FAM130A2 (CSRNP3) (NM_001172173) Human Over-expression Lysate
LY433313 100 µg

FAM130A2 (CSRNP3) (NM_001172173) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3129R), CF405S conjugate, 0.1mg/mL
BNC043129-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3129R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XYLT1 Human Gene Knockout Kit (CRISPR)
KN222133BN 1 Kit

XYLT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details