Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-30 (srd-30)

This Recombinant Serpentine receptor class delta-30 (srd-30) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-30, Protein srd-30

UniProt

P91209

Expression Region

1-324

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYQIIHSVLSTVGVSLNAFMMYLALTKSPKIMRPCSAIITIKTGTDILASIMSFFVMQR VITDGSSIIVIPTGPCTNFGKTACYVGHMLMLCFLEYNLIWMISSYIFRYYILYVRDPPI KHLVFVAFCLSIPSMVHMAAWFSFYDSNETTEDLSSYGIGSGEMALGGEVVYWSAITLIT QLFITAFLVVVAYIWIRETLCSFAVKMGSVKKDVKNLNKRLVKVINFQVFLPSFIFLGVI TFASMFTSKISYEYAQYAISVIFMFSPICSPFSYILFVPHYRNVIIGKKKQPKPHPEMCG PIRSNTRTTSISVTNNSSHLSSAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPTLC1 (C-term) Rabbit Polyclonal Antibody
AP12259PU-N 400 µL

SPTLC1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Factor Recombinant Rabbit monoclonal Antibody
HA750278 100 µL

Tissue Factor Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF488A conjugate, 0.1mg/mL
BNC882481-100 1x 100 µL

14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF488A conjugate, 0.1mg/mL
BNC880429-100 1x 100 µL

CD19 (CVID3/429), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Gastric Mucin-6/MUC6 Monoclonal Antibody
AN301775L-01 50 µL

Recombinant Gastric Mucin-6/MUC6 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Gastric Mucin-6/MUC6 Monoclonal Antibody
AN301775L-02 100 µL

Recombinant Gastric Mucin-6/MUC6 Monoclonal Antibody

Sign In for Pricing
View Details