Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6Y1 (OR6Y1)

This Recombinant Human Olfactory receptor 6Y1 (OR6Y1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Olfactory receptor 6Y1, Olfactory receptor 6Y2, Olfactory receptor OR1-11

UniProt

Q8NGX8

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIILEVDNHTVTTRFILLGFPTRPAFQLLFFSIFLATYLLTLLENLLIILAIHSDGQL HKPMYFFLSHLSFLEMWYVTVISPKMLVDFLSHDKSISFNGCMTQLYFFVTFVCTEYILL AIMAFDRYVAICNPLRYPVIMTNQLCGTLAGGCWFCGLMTAMIKMVFIAQLHYCGMPQIN HYFCDISPLLNVSCEDASQAEMVDFFLALMVIAIPLCVVVASYAAILATILRIPSAQGRQ KAFSTCASHLTVVILFYSMTLFTYARPKLMYAYNSNKVVSVLYTVIVPLLNPIIYCLRNH EVKAALRKTIHCRGSGPQGNGAFSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H11B Human qPCR Primer Pair (NM_001085394)
HP204271 200 Reactions

ZC3H11B Human qPCR Primer Pair (NM_001085394)

Sign In for Pricing
View Details
WS2B siRNA Oligos set (Human)
50468171 3x 5 nmol

WS2B siRNA Oligos set (Human)

Sign In for Pricing
View Details
Goose 6-Pyruvoyl Tetrahydrobiopterin Synthase (PTS) ELISA Kit
MBS9925940 Inquire

Goose 6-Pyruvoyl Tetrahydrobiopterin Synthase (PTS) ELISA Kit

Sign In for Pricing
View Details
Rat Cyp11b3 ELISA Kit
ELI-49308r 96 Tests

Rat Cyp11b3 ELISA Kit

Sign In for Pricing
View Details
Galectin 3-binding protein (GAL3BP) Rat ELISA Kit
D5896 96 Tests

Galectin 3-binding protein (GAL3BP) Rat ELISA Kit

Sign In for Pricing
View Details
METTL15 sgRNA CRISPR Lentivector (Human) (Target 2)
K2782903 1.0 µg DNA

METTL15 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details