Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4A16 (OR4A16)

This Recombinant Human Olfactory receptor 4A16 (OR4A16) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Olfactory receptor 4A16, Olfactory receptor OR11-117

UniProt

Q8NH70

Expression Region

1-328

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRPSSNVTEFVLLGLTQDPDVKKTLFVMFLLIYIVTMVGNLLIWVTTIGSPSLGSLMYFF LAYLSLMDAIYSTAMSPKLMIDLLCDKIAISLSACMGQLFIEHLLGGAEVFLLVVMAYDR YVAISKPLHYLNIMNRLVCILLLVVAMIGGFVHSVVQIVFLYSLPICGPNVIDHSVCDMY PLLELLCLDTYFIGLTVVANGGIICMVIFTFLLISCGVILNFLKTYSQEERHKALPTCIS HIIVVALVFVPCIFMYVRPVSNFPFDKLMTVFYSIITLMLNPLIYSLRQSEMKNAMKNLW CEKLSIVRKRVSPTLNIFIPSSKATNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Enterobacteria phage T4 (Bacteriophage T4) sp Polyclonal Antibody
MBS7157457 Inquire

Rabbit anti-Enterobacteria phage T4 (Bacteriophage T4) sp Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit NCOA62 Antibody
orb1529642-01 10 µL

Rabbit NCOA62 Antibody

Sign In for Pricing
View Details
Rabbit NCOA62 Antibody
orb1529642-02 100 µL

Rabbit NCOA62 Antibody

Sign In for Pricing
View Details
Recombinant Rhizobium etli Threonine--tRNA ligase (thrS), partial
MBS1363361 Inquire

Recombinant Rhizobium etli Threonine--tRNA ligase (thrS), partial

Sign In for Pricing
View Details
LentimiRa-Off-rno-miR-876 Vector
mr30652 500 ng

LentimiRa-Off-rno-miR-876 Vector

Sign In for Pricing
View Details
ESRRG Antibody; FITC conjugated
MBS7005859-01 0.05 mg

ESRRG Antibody; FITC conjugated

Sign In for Pricing
View Details