Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ZK757.1 (ZK757.1)

This Recombinant Uncharacterized protein ZK757.1 (ZK757.1) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Uncharacterized protein ZK757.1

UniProt

P34679

Expression Region

1-328

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYNNISLNTITTTPLTYRDRITFEFSVHGTCVVFNLFLCIFFICRPHLLRTFKPTIFFV TLGTFVLSLPLFFLQFYLVVFLWSLVEPRYTIAVCTLVKCITSSTTSCAQVLPLAVAIYR YFIVVRNKKMPSWFVVVVHSIISFIFFVIAILNFPLGEFETNDQCAVLRFSKAMEAVRIS LTLGLNLFAVFINVAIYTFVKKYDKRNVDVHRRRVQLTYSMLLQSMIPILVSIPLLVGSF DFYFGSLFELLWGYTLPSGFTSRWYATTFLSPLLTPISSMLSLRTIRHELLSIILSSFLF TGTRKISNLVTKTSKTNVAPHSSDYSSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBX2 (NM_001485) Human Recombinant Protein
E45H31956E1 50 µg

GBX2 (NM_001485) Human Recombinant Protein

Sign In for Pricing
View Details
BCYRN1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV719659 1.0 µg DNA

BCYRN1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
mmu-miR-7030-5p miRNA Inhibitor
MIM02827 2x 5.0 nmol

mmu-miR-7030-5p miRNA Inhibitor

Sign In for Pricing
View Details
Goat anti-human Superoxide Dismutase (SOD) IgG fraction (polyclonal)
PA-814-9 1 mg

Goat anti-human Superoxide Dismutase (SOD) IgG fraction (polyclonal)

Sign In for Pricing
View Details
PEF1a-OGT-HA-Neo Plasmid
PVT85104 2 µg

PEF1a-OGT-HA-Neo Plasmid

Sign In for Pricing
View Details
SLC12A1 Antibody
E38QA5896 100 µL

SLC12A1 Antibody

Sign In for Pricing
View Details