Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ZK757.1 (ZK757.1)

This Recombinant Uncharacterized protein ZK757.1 (ZK757.1) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Uncharacterized protein ZK757.1

UniProt

P34679

Expression Region

1-328

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYNNISLNTITTTPLTYRDRITFEFSVHGTCVVFNLFLCIFFICRPHLLRTFKPTIFFV TLGTFVLSLPLFFLQFYLVVFLWSLVEPRYTIAVCTLVKCITSSTTSCAQVLPLAVAIYR YFIVVRNKKMPSWFVVVVHSIISFIFFVIAILNFPLGEFETNDQCAVLRFSKAMEAVRIS LTLGLNLFAVFINVAIYTFVKKYDKRNVDVHRRRVQLTYSMLLQSMIPILVSIPLLVGSF DFYFGSLFELLWGYTLPSGFTSRWYATTFLSPLLTPISSMLSLRTIRHELLSIILSSFLF TGTRKISNLVTKTSKTNVAPHSSDYSSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gnai2 Rat shRNA Lentiviral Particle (Locus ID 81664)
TL711166V 500 µL Each

Gnai2 Rat shRNA Lentiviral Particle (Locus ID 81664)

Sign In for Pricing
View Details
Recombinant Human beta-Ureidopropionase/UPB1 (C-6His)
32-7188-10 10 µg

Recombinant Human beta-Ureidopropionase/UPB1 (C-6His)

Sign In for Pricing
View Details
IL-5 Polyclonal Antibody
MBS9244042-01 0.1 mL

IL-5 Polyclonal Antibody

Sign In for Pricing
View Details
IL-5 Polyclonal Antibody
MBS9244042-02 5x 0.1 mL

IL-5 Polyclonal Antibody

Sign In for Pricing
View Details
Kinesis Hollow Cathode Lamp Molybdenum 37mm Varian
CHR5787 1 Each

Kinesis Hollow Cathode Lamp Molybdenum 37mm Varian

Sign In for Pricing
View Details
Lentiviral human KRT37 sgRNA gene knockout kit - Lentiviral human KRT37 sgRNA gene knockout kit (100)
GTR15396565 1 Vial

Lentiviral human KRT37 sgRNA gene knockout kit - Lentiviral human KRT37 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details