Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine G-protein coupled bile acid receptor 1 (GPBAR1)

This Recombinant Bovine G-protein coupled bile acid receptor 1 (GPBAR1) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

G-protein coupled bile acid receptor 1

UniProt

Q862A9

Expression Region

1-329

Origin

Bos taurus (Bovine)

Field of Research

Gastroenterology & Hepatology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNSTREVPSPVPAGALGLSLALASLIVAANLLLAVGIAGDRRLRSPPAGCFFLSLLLA GLLTGLALPALPVLWSQSRRGYWSCLFLYLAPNFCFLSLLANLLLVHGERYMAVLRPLRP RGSMRLALLLTWAAPLLFASLPALGWNHWAPGGNCSSQAVFPAPYLYLEIYGLLLPAVGA AALLSVRVLVTAHRQLQDIRRLERAVCRGAPSALARALTWRQARAQAGATLLFGLCWGPY VATLLLSVLAFEQRPPLGPGTLLSLISLGSASAAAVPVAMGLGDQRYTGPWRVAAQKWLR MLRGRPQSSPGPSTAYHTSSQSSVDLDLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-100 1x 100 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details