Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1N2 (OR1N2)

This Recombinant Human Olfactory receptor 1N2 (OR1N2) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Olfactory receptor 1N2, Olfactory receptor OR9-23

UniProt

Q8NGR9

Expression Region

1-330

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGFYLRRSHELQGMGKPGRVNQTTVSDFLLLGLSEWPEEQPLLFGIFLGMYLVTMVGNL LIILAISSDPHLHTPMYFFLANLSLTDACFTSASIPKMLANIHTQSQIISYSGCLAQLYF LLMFGGLDNCLLAVMAYDRYVAICQPLHYSTSMSPQLCALMLGVCWVLTNCPALMHTLLL TRVAFCAQKAIPHFYCDPSALLKLACSDTHVNELMIITMGLLFLTVPLLLIVFSYVRIFW AVFVISSPGGRWKAFSTCGSHLTVVLLFYGSLMGVYLLPPSTYSTERESRAAVLYMVIIP TLNPFIYSLRNRDMKEALGKLFVSGKTFFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCC36 (BRCC3) Mouse Monoclonal Antibody [Clone ID: OTI6G7]
CF811409 100 µg

BRCC36 (BRCC3) Mouse Monoclonal Antibody [Clone ID: OTI6G7]

Sign In for Pricing
View Details
Western Blot Boxes
B1203 6 Units/Pack

Western Blot Boxes

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
Recombinant SOX9 Antibody
RC-4165-01 50 μL

Recombinant SOX9 Antibody

Sign In for Pricing
View Details