Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1N2 (OR1N2)

This Recombinant Human Olfactory receptor 1N2 (OR1N2) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Olfactory receptor 1N2, Olfactory receptor OR9-23

UniProt

Q8NGR9

Expression Region

1-330

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGFYLRRSHELQGMGKPGRVNQTTVSDFLLLGLSEWPEEQPLLFGIFLGMYLVTMVGNL LIILAISSDPHLHTPMYFFLANLSLTDACFTSASIPKMLANIHTQSQIISYSGCLAQLYF LLMFGGLDNCLLAVMAYDRYVAICQPLHYSTSMSPQLCALMLGVCWVLTNCPALMHTLLL TRVAFCAQKAIPHFYCDPSALLKLACSDTHVNELMIITMGLLFLTVPLLLIVFSYVRIFW AVFVISSPGGRWKAFSTCGSHLTVVLLFYGSLMGVYLLPPSTYSTERESRAAVLYMVIIP TLNPFIYSLRNRDMKEALGKLFVSGKTFFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Perfluorooctanoate
TRC-E192630-100MG 100 mg

Ethyl Perfluorooctanoate

Sign In for Pricing
View Details
DAO Polyclonal Antibody
E-AB-60889-01 60 µL

DAO Polyclonal Antibody

Sign In for Pricing
View Details
DAO Polyclonal Antibody
E-AB-60889-02 120 µL

DAO Polyclonal Antibody

Sign In for Pricing
View Details
DAO Polyclonal Antibody
E-AB-60889-03 200 µL

DAO Polyclonal Antibody

Sign In for Pricing
View Details
IL-6R, AlpHcAbs® Human
HA710329 100 µg

IL-6R, AlpHcAbs® Human

Sign In for Pricing
View Details
Ionotropic glutamate receptor 2 + 3 Recombinant Rabbit Monoclonal Antibody [JE33-28]
HA721405 100 µL

Ionotropic glutamate receptor 2 + 3 Recombinant Rabbit Monoclonal Antibody [JE33-28]

Sign In for Pricing
View Details