Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10S1 (OR10S1)

This Recombinant Human Olfactory receptor 10S1 (OR10S1) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Olfactory receptor 10S1, Olfactory receptor OR11-279

UniProt

Q8NGN2

Expression Region

1-331

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAKHSSLFFLLFLLIYSITVAGNLLILL TVGSDSHLSLPMYHFLGHLSFLDACLSTVTVPKVMAGLLTLDGKVISFEGCAVQLYCFHF LASTECFLYTVMAYDRYLAICQPLHYPVAMNRRMCAEMAGITWAIGATHAAIHTSLTFRL LYCGPCHIAYFFCDIPPVLKLACTDTTINELVMLASIGIVAAGCLILIVISYIFIVAAVL RIRTAQGRQRAFSPCTAQLTGVLLYYVPPVCIYLQPRSSEAGAGAPAVFYTIVTPMLNPF IYTLRNKEVKHALQRLLCSSFRESTAGSPPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2V2, ID (UBE2V2, MMS2, UEV2, Ubiquitin-conjugating enzyme E2 variant 2, DDVit 1, Enterocyte differentiation-associated factor 1, Enterocyte differentiation-promoting factor 1, MMS2 homolog, Vitamin D3-inducible protein) (AP) discontinued
043536-AP 200 µL

UBE2V2, ID (UBE2V2, MMS2, UEV2, Ubiquitin-conjugating enzyme E2 variant 2, DDVit 1, Enterocyte differentiation-associated factor 1, Enterocyte differentiation-promoting factor 1, MMS2 homolog, Vitamin D3-inducible protein) (AP) discontinued

Sign In for Pricing
View Details
MED26 Rabbit Polyclonal Antibody
orb576716 100 µL

MED26 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse H13 (NM_010376) AAV Particle
MR217073A1V 250 µL

Mouse H13 (NM_010376) AAV Particle

Sign In for Pricing
View Details
G - plus 17
OD305R-1PK 1 unit

G - plus 17

Sign In for Pricing
View Details
Recombinant Bordetella Avium BAV2213 Protein (aa 1-201)
VAng-Lsx4053-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Avium BAV2213 Protein (aa 1-201)

Sign In for Pricing
View Details
2x PCR Red Mix
TBS4004 2.0 mL

2x PCR Red Mix

Sign In for Pricing
View Details