Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-55 (srd-55)

This Recombinant Serpentine receptor class delta-55 (srd-55) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-55, Protein srd-55

UniProt

Q09572

Expression Region

1-334

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSSNRIVPFVDIYFKIYFYGGLTFQLLLLTLILTKSPSILTNLKFFLINTCFLQIIL ISLGFFTQHRSLPNIDSFAVLPRGPCREFGPDVCFSAYHFFLGVALCVGLGISNTIIFRF QALRKGRVSRSRIFTMISLTYIPSSITIILPFTSSWDFEKVRSLTYIEHPKYDLSIYEPF VGFHNIASFQFTLATLLLVIGAYAIPAISGFLTSRVIHLINDNRGMSLKTKEQSKTLAYG LACQTFLPVICYIPVASCYIFSQMTSVELLLNEHLLGILICFPSFVDPFISFYFIVPYRQ ALLGLFKCRKTKPLNIVITVRHLSKRNPSIVDSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat 4-1BB Ligand / TNFSF9 Protein, His, Flag Tag (MALS verified)
41L-R52D3-100ug 100 µg

Rat 4-1BB Ligand / TNFSF9 Protein, His, Flag Tag (MALS verified)

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF405S conjugate, 0.1mg/mL
BNC041989-100 1x 100 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (ARF1/2117), 0.2mg/mL
BNUB2117-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (ARF1/2117), 0.2mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), Biotin conjugate, 0.1mg/mL
BNCB2039-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C20orf112 (NOL4L) Human Gene Knockout Kit (CRISPR)
KN420718 1 Kit

C20orf112 (NOL4L) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (139H2), 1mg/mL
BNUM0925-50 1x 50 µL

Mucin 1 / EMA / Episialin / CD227 (139H2), 1mg/mL

Sign In for Pricing
View Details