Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryzias latipes Putative violet-sensitive opsin

This Recombinant Oryzias latipes Putative violet-sensitive opsin spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

Putative violet-sensitive opsin, KFH-V, Violet cone photoreceptor pigment

UniProt

P87368

Expression Region

1-334

Origin

Oryzias latipes (Medaka fish) (Japanese ricefish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKYFYLYENISKVGPYDGPQYYLAPTWAFYLQAAFMGFVFFVGTPLNFVVLLATAKYKK LRVPLNYILVNITFAGFIFVTFSVSQVFLASVRGYYFFGQTLCALEAAVGAVAGLVTSWS LAVLSFERYLVICKPFGAFKFGSNHALAAVIFTWFMGVVRCPPFFGWSRYIPEGLGCSCG PDWYTNCEEFSCASYSKFLLVTCFICPITIIIFSYSQLLGALRAVAAQQAESASTQKAEK EVSRMIIVMVASFVTCYGPYALTAQYYAYSQDENKDYRLVTIPAFFSKSSCVYNPLIYAF MNKQFNGCIMEMVFGKKMEEASEVSSKTEVSTDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUPT5H Antibody
orb1268246 400 μl

SUPT5H Antibody

Sign In for Pricing
View Details
LIGHT/Tnfsf14 Rabbit Polyclonal Antibody (Biotin)
orb2591951 100 µg

LIGHT/Tnfsf14 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
mPEG-FA, 30K
MF001057-30K Inquire

mPEG-FA, 30K

Sign In for Pricing
View Details
Rabbit Monoclonal Casein Kinase 2 alpha Antibody (2B6)
NBP3-15160 100 µL

Rabbit Monoclonal Casein Kinase 2 alpha Antibody (2B6)

Sign In for Pricing
View Details
Recombinant Human UbcH3/Cdc34 Protein
NBP2-61361-1000ug 1000 µg

Recombinant Human UbcH3/Cdc34 Protein

Sign In for Pricing
View Details
sphingosine 1 phosphate phosphatase 1 (SGPP1) (NM_030791) Human Tagged ORF Clone
RC209497 10 µg

sphingosine 1 phosphate phosphatase 1 (SGPP1) (NM_030791) Human Tagged ORF Clone

Sign In for Pricing
View Details