Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryzias latipes Putative violet-sensitive opsin

This Recombinant Oryzias latipes Putative violet-sensitive opsin spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

Putative violet-sensitive opsin, KFH-V, Violet cone photoreceptor pigment

UniProt

P87368

Expression Region

1-334

Origin

Oryzias latipes (Medaka fish) (Japanese ricefish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKYFYLYENISKVGPYDGPQYYLAPTWAFYLQAAFMGFVFFVGTPLNFVVLLATAKYKK LRVPLNYILVNITFAGFIFVTFSVSQVFLASVRGYYFFGQTLCALEAAVGAVAGLVTSWS LAVLSFERYLVICKPFGAFKFGSNHALAAVIFTWFMGVVRCPPFFGWSRYIPEGLGCSCG PDWYTNCEEFSCASYSKFLLVTCFICPITIIIFSYSQLLGALRAVAAQQAESASTQKAEK EVSRMIIVMVASFVTCYGPYALTAQYYAYSQDENKDYRLVTIPAFFSKSSCVYNPLIYAF MNKQFNGCIMEMVFGKKMEEASEVSSKTEVSTDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fel d 1 IgE Human Monoclonal Antibody
orb2956720-01 50 µg

Fel d 1 IgE Human Monoclonal Antibody

Sign In for Pricing
View Details
Fel d 1 IgE Human Monoclonal Antibody
orb2956720-02 100 µg

Fel d 1 IgE Human Monoclonal Antibody

Sign In for Pricing
View Details
Fel d 1 IgE Human Monoclonal Antibody
orb2956720-03 1 mg

Fel d 1 IgE Human Monoclonal Antibody

Sign In for Pricing
View Details
PABX-set siRNA/shRNA/RNAi Lentivector (Human)
35916091 4x 500 ng

PABX-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Integrin α2 CRISPR/Cas9 KO Plasmid (m2)
sc-421159-KO-2 20 µg

Integrin α2 CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details
Sec8 (EXOC4) (NM_021807) Human Tagged ORF Clone Lentiviral Particle
RC209487L3V 200 µL

Sec8 (EXOC4) (NM_021807) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details