Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-10 (sra-10)

This Recombinant Serpentine receptor class alpha-10 (sra-10) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-10, Protein sra-10

UniProt

Q20405

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPITANSSKCATEDQMILQTSLLLRINVIIMTIVAIITFILTYKALFILKIRPIFHSST KILLYTSLLFVNVHAVIFMVIQNTALIRSFTLSDKPCEIMRTTLECRFQNHVLIFGIAGV NFNQFGLTVDRLLATIIPQSYSHMGALPGVILSVLVVACSIAAPLIIAIGDPYDDIVPNC FFFPEHSAPRANIFLVTLSTLVITSIFLNFIIIYANKKLEKGCRTRFYVTQRYQKREALI STRIISYIAASQFLGLTLYSTMVLTLRLHKSMIPISIYHNMVWWAYTVPFAAVSLPALLI YRINQVGSNRKRVINRITAKVETQEEHMKSLKELWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHD3 Rabbit Monoclonal Antibody
orb866742 100 µL

CHD3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ACSF3 Rabbit pAb
MBS9148537-01 0.02 mL

ACSF3 Rabbit pAb

Sign In for Pricing
View Details
ACSF3 Rabbit pAb
MBS9148537-02 0.1 mL

ACSF3 Rabbit pAb

Sign In for Pricing
View Details
ACSF3 Rabbit pAb
MBS9148537-03 5x 0.1 mL

ACSF3 Rabbit pAb

Sign In for Pricing
View Details
TNFRSF11B antibody
10R-10841 100 ug

TNFRSF11B antibody

Sign In for Pricing
View Details
ZSCAN31 Antibody
OAGA02133-100UL 100 µL

ZSCAN31 Antibody

Sign In for Pricing
View Details