Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-10 (sra-10)

This Recombinant Serpentine receptor class alpha-10 (sra-10) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-10, Protein sra-10

UniProt

Q20405

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPITANSSKCATEDQMILQTSLLLRINVIIMTIVAIITFILTYKALFILKIRPIFHSST KILLYTSLLFVNVHAVIFMVIQNTALIRSFTLSDKPCEIMRTTLECRFQNHVLIFGIAGV NFNQFGLTVDRLLATIIPQSYSHMGALPGVILSVLVVACSIAAPLIIAIGDPYDDIVPNC FFFPEHSAPRANIFLVTLSTLVITSIFLNFIIIYANKKLEKGCRTRFYVTQRYQKREALI STRIISYIAASQFLGLTLYSTMVLTLRLHKSMIPISIYHNMVWWAYTVPFAAVSLPALLI YRINQVGSNRKRVINRITAKVETQEEHMKSLKELWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM183B AAV siRNA Pooled Vector
46957161 1.0 µg

TMEM183B AAV siRNA Pooled Vector

Sign In for Pricing
View Details
DsdA Antibody
orb828753 2 mg

DsdA Antibody

Sign In for Pricing
View Details
Gm15127 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
21898124 3x 1.0µg DNA

Gm15127 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Chchd2 AAV siRNA Pooled Vector
16021164 1.0 µg

Chchd2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
EU Optical robust flat 8-cap strip
B79709 120 Strips/Bag

EU Optical robust flat 8-cap strip

Sign In for Pricing
View Details
Thomsen-Friedenreich Antigen Antibody / CD176
V8325-100UG 100 µg

Thomsen-Friedenreich Antigen Antibody / CD176

Sign In for Pricing
View Details