Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Trace amine-associated receptor 5 (TAAR5)

This Recombinant Pan troglodytes Trace amine-associated receptor 5 (TAAR5) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 5, TaR-5, Trace amine receptor 5

UniProt

Q5QD28

Expression Region

1-337

Origin

Pan troglodytes (Chimpanzee)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNLFVAFAVS YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDPLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKNL AGAAKHDRKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Momelotinib Benzoic Acid
TRC-M965620-50MG 50 mg

Momelotinib Benzoic Acid

Sign In for Pricing
View Details
Mouse Rn7sk activation kit by CRISPRa
GA203650 1 Kit

Mouse Rn7sk activation kit by CRISPRa

Sign In for Pricing
View Details
CD45 / LCA Rat Monoclonal Antibody [Clone ID: EM-05]
AM26024PP-N 100 µg

CD45 / LCA Rat Monoclonal Antibody [Clone ID: EM-05]

Sign In for Pricing
View Details
Diphenyl Ditelluride
TRC-D491480-1G 1 g

Diphenyl Ditelluride

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (rLAMP4/824), CF488A conjugate, 0.1mg/mL
BNC883434-500 1x 500 µL

CD68 (Macrophage Marker) (rLAMP4/824), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JKAMP (NM_001098625) Human Over-expression Lysate
LY420648 100 µg

JKAMP (NM_001098625) Human Over-expression Lysate

Sign In for Pricing
View Details