Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Trace amine-associated receptor 5 (TAAR5)

This Recombinant Pan troglodytes Trace amine-associated receptor 5 (TAAR5) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 5, TaR-5, Trace amine receptor 5

UniProt

Q5QD28

Expression Region

1-337

Origin

Pan troglodytes (Chimpanzee)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNLFVAFAVS YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDPLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKNL AGAAKHDRKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YPEL5 (NM_001127400) Human Over-expression Lysate
LC426782 20 µg

YPEL5 (NM_001127400) Human Over-expression Lysate

Sign In for Pricing
View Details
RHPN1 (NM_052924) Human Recombinant Protein
TP306645M 100 µg

RHPN1 (NM_052924) Human Recombinant Protein

Sign In for Pricing
View Details
UBE2G2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]
TA505262BM 100 µL

UBE2G2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]

Sign In for Pricing
View Details
PTPN5 (NM_032781) Human Recombinant Protein
TP317371M 100 µg

PTPN5 (NM_032781) Human Recombinant Protein

Sign In for Pricing
View Details
Ro 32-3555
TRC-R700905-5MG 5 mg

Ro 32-3555

Sign In for Pricing
View Details
SMARCD1 (NM_003076) Human Over-expression Lysate
LY401074 100 µg

SMARCD1 (NM_003076) Human Over-expression Lysate

Sign In for Pricing
View Details