Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trace amine-associated receptor 5 (TAAR5)

This Recombinant Human Trace amine-associated receptor 5 (TAAR5) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 5, TaR-5, Trace amine receptor 5, Putative neurotransmitter receptor

UniProt

O14804

Expression Region

1-337

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVS YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSL AGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
(aS,4R)-a-Ethyl-2-oxo-4-propyl-1-pyrrolidineacetic Acid (~85:15 d.r.)
TRC-E945390-25MG 25 mg

(aS,4R)-a-Ethyl-2-oxo-4-propyl-1-pyrrolidineacetic Acid (~85:15 d.r.)

Sign In for Pricing
View Details
Melanoma Marker (PNL2), CF488A conjugate, 0.1mg/mL
BNC880894-100 1x 100 µL

Melanoma Marker (PNL2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,2-Difluoro-2-(fluorosulfonyl)acetic Acid
TRC-D446110-1G 1 g

2,2-Difluoro-2-(fluorosulfonyl)acetic Acid

Sign In for Pricing
View Details
D-Mannuronic Acid Sodium Salt
TRC-D208470-250MG 250 mg

D-Mannuronic Acid Sodium Salt

Sign In for Pricing
View Details