Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trace amine-associated receptor 5 (TAAR5)

This Recombinant Human Trace amine-associated receptor 5 (TAAR5) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 5, TaR-5, Trace amine receptor 5, Putative neurotransmitter receptor

UniProt

O14804

Expression Region

1-337

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVS YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSL AGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIV1 p24 Mouse Monoclonal Antibody [12G2] - BSA and Azide free (Detector)
HA600009 100 µg

HIV1 p24 Mouse Monoclonal Antibody [12G2] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
CD81 Recombinant Monoclonal Mouse Antibody (2304.81), CF®568 Conjugate - Biotium Choice
P014-568-500 1x 500 µL

CD81 Recombinant Monoclonal Mouse Antibody (2304.81), CF®568 Conjugate - Biotium Choice

Sign In for Pricing
View Details
MSRB2 Rabbit Polyclonal Antibody
TA378710 100 µL

MSRB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Interleukin 8 (IL8) ELISA Kit
RDR-IL8-p-01 96 Tests

Porcine Interleukin 8 (IL8) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 8 (IL8) ELISA Kit
RDR-IL8-p-02 48 Tests

Porcine Interleukin 8 (IL8) ELISA Kit

Sign In for Pricing
View Details
Canine Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES) ELISA Kit
RD-RANTES-c-01 96 Tests

Canine Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES) ELISA Kit

Sign In for Pricing
View Details