Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative trace amine-associated receptor 3 (TAAR3)

This Recombinant Human Putative trace amine-associated receptor 3 (TAAR3) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Putative trace amine-associated receptor 3, TaR-3, Trace amine receptor 3, G-protein coupled receptor 57

UniProt

Q9P1P4

Expression Region

1-343

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLTYIPEDLSSCPKFVNKILSSHQPLFSCPGDNVFGYDWSHDYPLFGNLVIMVSISHFK QLHSPTNFLILSMATTDFLLGFVIMPYSIMRSVESCWYFGDGFCKFHTSFDMMLRLTSIF HLCSIAIDRFYAVCYPLHYTTKMTNSTIKQLLAFCWSVPALFSFGLVLSEADVSGMQSYK ILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSKQHARVISHVPENTKG AVKKHLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPILILDLLVWLRYF NSTCNPLIHGFFNPWFQKAFKYIVSGKIFSSHSETANLFPEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1218 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4238307 1.0 µg DNA

Olfr1218 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Taf5 3'UTR Luciferase Stable Cell Line
TU221549 1.0 mL

Taf5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Polr2e (NM_025554) Mouse Recombinant Protein
PM48252M5 20 µg

Polr2e (NM_025554) Mouse Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Lrrc30 shRNA (UAS) - Lentiviral mouse Lrrc30 shRNA (UAS, RFP) plasmid
GTR15241837 1 Vial

Lentiviral mouse Lrrc30 shRNA (UAS) - Lentiviral mouse Lrrc30 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Isosakuranin
MBS5760527 Inquire

Isosakuranin

Sign In for Pricing
View Details
FAM162B Blocking Peptide
MBS9632842-01 1 mg

FAM162B Blocking Peptide

Sign In for Pricing
View Details