Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative trace amine-associated receptor 3 (TAAR3)

This Recombinant Human Putative trace amine-associated receptor 3 (TAAR3) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Putative trace amine-associated receptor 3, TaR-3, Trace amine receptor 3, G-protein coupled receptor 57

UniProt

Q9P1P4

Expression Region

1-343

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLTYIPEDLSSCPKFVNKILSSHQPLFSCPGDNVFGYDWSHDYPLFGNLVIMVSISHFK QLHSPTNFLILSMATTDFLLGFVIMPYSIMRSVESCWYFGDGFCKFHTSFDMMLRLTSIF HLCSIAIDRFYAVCYPLHYTTKMTNSTIKQLLAFCWSVPALFSFGLVLSEADVSGMQSYK ILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSKQHARVISHVPENTKG AVKKHLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPILILDLLVWLRYF NSTCNPLIHGFFNPWFQKAFKYIVSGKIFSSHSETANLFPEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prr24 3'UTR Luciferase Stable Cell Line
TU117066 1.0 mL

Prr24 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse monoclonal antibody to human Laminin a4 chain, clone 6C3
A2-604-100-01 100 µg

Mouse monoclonal antibody to human Laminin a4 chain, clone 6C3

Sign In for Pricing
View Details
Mouse monoclonal antibody to human Laminin a4 chain, clone 6C3
A2-604-100-02 500 µg

Mouse monoclonal antibody to human Laminin a4 chain, clone 6C3

Sign In for Pricing
View Details
Mouse monoclonal antibody to human Laminin a4 chain, clone 6C3
A2-604-100-03 1 mg

Mouse monoclonal antibody to human Laminin a4 chain, clone 6C3

Sign In for Pricing
View Details
CHGB (C) Antibody, Rabbit Polyclonal
orb386824 100 µL

CHGB (C) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Rat Caspase 4 (CASP4) ELISA Kit
orb1949569-01 48 Tests

Rat Caspase 4 (CASP4) ELISA Kit

Sign In for Pricing
View Details