Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 8b (Taar8b)

This Recombinant Rat Trace amine-associated receptor 8b (Taar8b) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8b, TaR-8b, Trace amine receptor 8b, Trace amine receptor 7, TaR-7

UniProt

Q923Y3

Expression Region

1-344

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQATLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDAAFCYSSLF HLCFISVDRYIAVTEPLVYPTKFTMSVSGICISISWILPLVYSSAVFYTGISATGIENLV SALNCVGGCQVAINQDWVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSISGSKGE SSLESHKARVAKRERKAAKTLGVTVMAFMVSWLPYTIDTLIDAFMGFITPAYVYEICGWI AYYNSAMNPLIYAFFYPWFRKAIKLILSGKILKGHSSTTSLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KREMEN2 Adenovirus (Human)
25918051 1.0 mL

KREMEN2 Adenovirus (Human)

Sign In for Pricing
View Details
Biotinylated Anti-CA9 (girentuximab biosimilar) mAb
MBS1880473-01 0.05 mg

Biotinylated Anti-CA9 (girentuximab biosimilar) mAb

Sign In for Pricing
View Details
Biotinylated Anti-CA9 (girentuximab biosimilar) mAb
MBS1880473-02 0.1 mg

Biotinylated Anti-CA9 (girentuximab biosimilar) mAb

Sign In for Pricing
View Details
Biotinylated Anti-CA9 (girentuximab biosimilar) mAb
MBS1880473-03 5x 0.1 mg

Biotinylated Anti-CA9 (girentuximab biosimilar) mAb

Sign In for Pricing
View Details
Zfp217 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
50877064 1.0 µg DNA

Zfp217 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Phospho-AKT1 (Thr308) Rabbit Polyclonal Antibody
AF5734 50 µL

Phospho-AKT1 (Thr308) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details