Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 8b (Taar8b)

This Recombinant Rat Trace amine-associated receptor 8b (Taar8b) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8b, TaR-8b, Trace amine receptor 8b, Trace amine receptor 7, TaR-7

UniProt

Q923Y3

Expression Region

1-344

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQATLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDAAFCYSSLF HLCFISVDRYIAVTEPLVYPTKFTMSVSGICISISWILPLVYSSAVFYTGISATGIENLV SALNCVGGCQVAINQDWVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSISGSKGE SSLESHKARVAKRERKAAKTLGVTVMAFMVSWLPYTIDTLIDAFMGFITPAYVYEICGWI AYYNSAMNPLIYAFFYPWFRKAIKLILSGKILKGHSSTTSLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Ubiquitin (Ub) ELISA Kit
RD-Ub-Si-01 48T

Monkey Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Monkey Ubiquitin (Ub) ELISA Kit
RD-Ub-Si-02 96T

Monkey Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Rat Vasoactive Intestinal Peptide (VIP) Elisa Kit
EK720915 96 Well

Rat Vasoactive Intestinal Peptide (VIP) Elisa Kit

Sign In for Pricing
View Details
OX40/TNFRSF4/CD134 Protein, Human, Recombinant (C-hFc)
E51P01103 100 µg

OX40/TNFRSF4/CD134 Protein, Human, Recombinant (C-hFc)

Sign In for Pricing
View Details
Mesp1 3'UTR Lenti-reporter-Luc Vector
28371086 1.0 µg

Mesp1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
IGHG1 cDNA Clone
MBS1277118-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

IGHG1 cDNA Clone

Sign In for Pricing
View Details