Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 8b (Taar8b)

This Recombinant Rat Trace amine-associated receptor 8b (Taar8b) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8b, TaR-8b, Trace amine receptor 8b, Trace amine receptor 7, TaR-7

UniProt

Q923Y3

Expression Region

1-344

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQATLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDAAFCYSSLF HLCFISVDRYIAVTEPLVYPTKFTMSVSGICISISWILPLVYSSAVFYTGISATGIENLV SALNCVGGCQVAINQDWVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSISGSKGE SSLESHKARVAKRERKAAKTLGVTVMAFMVSWLPYTIDTLIDAFMGFITPAYVYEICGWI AYYNSAMNPLIYAFFYPWFRKAIKLILSGKILKGHSSTTSLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human ABCA2 (ATP binding cassette subfamily A member 2) Full Length
MPC1295K Each

Magic™ Membrane Protein Human ABCA2 (ATP binding cassette subfamily A member 2) Full Length

Sign In for Pricing
View Details
Cyanidin-3-arabinoside chloride
HCA18611-01 10 mg

Cyanidin-3-arabinoside chloride

Sign In for Pricing
View Details
Cyanidin-3-arabinoside chloride
HCA18611-02 25 mg

Cyanidin-3-arabinoside chloride

Sign In for Pricing
View Details
Cyanidin-3-arabinoside chloride
HCA18611-03 50 mg

Cyanidin-3-arabinoside chloride

Sign In for Pricing
View Details
Human Actin Alpha 2, Smooth Muscle (ACTa2) ELISA Kit
BSKH62371-01 48 Tests

Human Actin Alpha 2, Smooth Muscle (ACTa2) ELISA Kit

Sign In for Pricing
View Details
Human Actin Alpha 2, Smooth Muscle (ACTa2) ELISA Kit
BSKH62371-02 96 Tests

Human Actin Alpha 2, Smooth Muscle (ACTa2) ELISA Kit

Sign In for Pricing
View Details