Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 13D1 (OR13D1)

This Recombinant Human Olfactory receptor 13D1 (OR13D1) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Olfactory receptor 13D1, Olfactory receptor OR9-15

UniProt

Q8NGV5

Expression Region

1-346

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYRFTDFDVSNISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLVGLSQYPELQLFLF LLCLIMYMIILLGNSLLIIITILDSRLHTPMYFFLGNLSFLDICYTSSSIPPMLIIFMSE RKSISFIGCALQMVVSLGLGSTECVLLAVMAYDHYVAICNPLRYSIIMNGVLYVQMAAWS WIIGCLTSLLQTVLTMMLPFCGNNVIDHITCEILALLKLVCSDITINVLIMTVTNIVSLV ILLLLIFISYVFILSSILRINCAEGRKKAFSTCSAHSIVVILFYGSALFMYMKPKSKNTN TSDEIIGLSYGVVSPMLNPIIYSLRNKEVKEAVKKVLSRHLHLLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau (Ab-205) Antibody
8B7245-AAT 50 µg

Tau (Ab-205) Antibody

Sign In for Pricing
View Details
Atp5g1 (NM_007506) Mouse Tagged ORF Clone
MG200836 10 µg

Atp5g1 (NM_007506) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS646408 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
MMP3 Recombinant Antibody / Matrix Metalloproteinase 3
V3641IHC-7ML 7 mL

MMP3 Recombinant Antibody / Matrix Metalloproteinase 3

Sign In for Pricing
View Details
AAAS Antibody
KC-21976-01 50 μL

AAAS Antibody

Sign In for Pricing
View Details
AAAS Antibody
KC-21976-02 100 µL

AAAS Antibody

Sign In for Pricing
View Details