Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis Pheromone receptor 2 (PRA2)

This Recombinant Ustilago maydis Pheromone receptor 2 (PRA2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Pheromone receptor 2

UniProt

P31303

Expression Region

1-346

Origin

Ustilago maydis (Smut fungus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSGKENVSFGVLCLLAGCISTSSCLIHLQAKNIGVLLMMFWCFTGLVNKGINALAFNNS LRLAWTLGCDLSAIIERTWQFGLCCSALCVLQRLEGIASLRQAHSTVWDRKRRLLIDFGV GLGLPALQIPMFFIVQPYRLNVIENIGCSAPLYASVPALFIYHLWRLLVSLVCAVYAVLV LRWFMLRRRQFTAALSSQHSGLSQKKYFRLFALAICERVLVSAGQFYVIIQSLQIGGLLP YTSWAEVHTNFNRILFVPVDTIAHSSLLSLSILRWFSLTPAMALFVFFGLTEEAQSVYKA RWKALINLCSSKGKKQTDGRESLDLEAFESHGSKFSVLVQRDTVIC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iso-Butyl 4-Hydroxybenzoate-2,3,5,6-d4
TRC-I780101-1MG 1 mg

iso-Butyl 4-Hydroxybenzoate-2,3,5,6-d4

Sign In for Pricing
View Details
PDE1B (NM_001165975) Human Over-expression Lysate
LY431450 100 µg

PDE1B (NM_001165975) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit
E-EL-M3115-01 24 Tests

Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit

Sign In for Pricing
View Details
Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit
E-EL-M3115-02 48 Tests

Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit

Sign In for Pricing
View Details
Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit
E-EL-M3115-03 96 Tests

Mouse NOV (Nephroblastoma Overexpressed Gene) ELISA Kit

Sign In for Pricing
View Details
Human S100A9 (S100Calcium Binding Protein A9) ELISA Kit
E-EL-H6197-01 24 Tests

Human S100A9 (S100Calcium Binding Protein A9) ELISA Kit

Sign In for Pricing
View Details