Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis Pheromone receptor 2 (PRA2)

This Recombinant Ustilago maydis Pheromone receptor 2 (PRA2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Pheromone receptor 2

UniProt

P31303

Expression Region

1-346

Origin

Ustilago maydis (Smut fungus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSGKENVSFGVLCLLAGCISTSSCLIHLQAKNIGVLLMMFWCFTGLVNKGINALAFNNS LRLAWTLGCDLSAIIERTWQFGLCCSALCVLQRLEGIASLRQAHSTVWDRKRRLLIDFGV GLGLPALQIPMFFIVQPYRLNVIENIGCSAPLYASVPALFIYHLWRLLVSLVCAVYAVLV LRWFMLRRRQFTAALSSQHSGLSQKKYFRLFALAICERVLVSAGQFYVIIQSLQIGGLLP YTSWAEVHTNFNRILFVPVDTIAHSSLLSLSILRWFSLTPAMALFVFFGLTEEAQSVYKA RWKALINLCSSKGKKQTDGRESLDLEAFESHGSKFSVLVQRDTVIC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH6A1 (NM_005589) Human Over-expression Lysate
LC401715 20 µg

ALDH6A1 (NM_005589) Human Over-expression Lysate

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL
BNC881953-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KPNA4 (N-term) Rabbit Polyclonal Antibody
AP11806PU-N 400 µL

KPNA4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human ENPP5 Protein (His Tag)
PKSH031104 100 µg

Recombinant Human ENPP5 Protein (His Tag)

Sign In for Pricing
View Details
(E,E)-8-Oxogeranyl Acetate
TRC-O858415-1G 1 g

(E,E)-8-Oxogeranyl Acetate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS711426 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details