Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6J1 (OR6J1)

This Recombinant Human Olfactory receptor 6J1 (OR6J1) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Olfactory receptor 6J1, Olfactory receptor 6J2

UniProt

Q8NGC5

Expression Region

1-347

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNWTAAVTEFVLLGFSLSREVELLLLVLLLPTFLLTLLGNLLIISTVLSCSRLHTPMYF FLCNLSILDILFTSVISPKVLANLGSRDKTISFAGCITQCYFYFFLGTVEFLLLTVMSYD RYATICCPLRYTTIMRPSVCIGTVVFSWVGGFLSVLFPTILISQLPFCGSNIINHFFCDS GPLLALACADTTAIELMDFMLSSMVILCCIVLVAYSYTYIILTIVRIPSASGRKKAFNTC ASHLTIVIIPSGITVFIYVTPSQKEYLEINKIPLVLSSVVTPFLNPFIYTLRNDTVQGVL RDVWVRVRGVFEKRMRAVLRSRLSSNKDHQGRACSSPPCVYSVKLQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SMIM35 activation kit by CRISPRa
GA119343 1 Kit

Human SMIM35 activation kit by CRISPRa

Sign In for Pricing
View Details
Human SIGLEC14 activation kit by CRISPRa
GA119065 1 Kit

Human SIGLEC14 activation kit by CRISPRa

Sign In for Pricing
View Details
ZSCAN30 Human Gene Knockout Kit (CRISPR)
KN425851 1 Kit

ZSCAN30 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PMPCB (NM_004279) Human Recombinant Protein
TP315039M 100 µg

PMPCB (NM_004279) Human Recombinant Protein

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), 1mg/mL
BNUM1283-50 1x 50 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), 1mg/mL

Sign In for Pricing
View Details
EHD1 Rabbit Polyclonal Antibody
TA368222 100 µL

EHD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details