Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neoniphon aurolineatus Rhodopsin (rho)

This Recombinant Neoniphon aurolineatus Rhodopsin (rho) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P79809

Expression Region

1-347

Origin

Neoniphon aurolineatus (Yellowstriped squirrelfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TEGPDFYIPMVNTSGLVRSPYEYPQYYLVNPAAFAFLGAYMFFLIIIGFPVNFLTLYVTL EHKKLRTPLNYILLNLAVSDLFMVIGGFTTTMYSSMHGYFVLGRLGCNIEGFFATLGGMI SLWSLAVLAIERWVVVCKPISNFRFGENHAIMGVSMTWLLALSCTVPPLVGWSRYIPEGM QCACGIDYYTRAEGYNNESFVIYMFTCHFSVPLFIIFFCYGRLLCAVKEAAAAQQESETT QRAEREVTRMVVIMVIGFLVCWLPYASVAWFIFTHQGSEFGPLFMAIPSFFAKSSSIYNP VIYICMNKQFRQCMITTLFCGKNPFEGEEEGSSTKTEASSASSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
BNC940994-100 1x 100 µL

TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-100 1x 100 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF405S conjugate, 0.1mg/mL
BNC041706-100 1x 100 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details