Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus N-formyl peptide receptor 2 (FPR2)

This Recombinant Pongo pygmaeus N-formyl peptide receptor 2 (FPR2) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

N-formyl peptide receptor 2, FMLP-related receptor I, FMLP-R-I, Formyl peptide receptor-like 1

UniProt

P79236

Expression Region

1-348

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NFSTPLNEHEEVSYESAGYTVLQILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTIC YLNLPLADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDR CICVLHPVWAQNHRTVSLAMKVIIGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASW GGTPEERKNVAITMLTARGIIRFVIGFSMPMSIVAICYGLIAAKIHKKGMIKSSRPLRVL TAVVASFFICWFPFQLVALLSTVWLKEMLFYGKYKIINILVNPTSSLAFFNSCLNPMLYV FVGQDFRERLIRSLPTSLERALSEDSAPTNDTAAKCASPPAETELQAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-100 1x 100 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF568 conjugate, 0.1mg/mL
BNC681136-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF488A conjugate, 0.1mg/mL
BNC882475-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details