Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Green-sensitive opsin-2 (opn1mw2)

This Recombinant Danio rerio Green-sensitive opsin-2 (opn1mw2) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Green-sensitive opsin-2, Green cone photoreceptor pigment 2, Opsin RH2-2, Opsin-1, medium-wave-sensitive 2

UniProt

Q8AYM8

Expression Region

1-349

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGNNFYIPMSNRTGLVRSPYEYTQYYLADPWQFKALAFYMFFLICFGLPINVLTLL VTAQHKKLRQPLNYILVNLAFAGTIMAFFGFTVTFYCSINGYMALGPTGCAIEGFFATLG GQVALWSLVVLAIERYIVVCKPMGSFKFSSNHAMAGIAFTWVMASSCAVPPLFGWSRYIP EGMQTSCGPDYYTLNPEFNNESYVLYMFSCHFCVPVTTIFFTYGSLVCTVKAAAAQQQES ESTQKAEREVTRMVILMVLGFLVAWVPYASFAAWIFFNRGAAFSAQAMAIPAFFSKASAL FNPIIYVLLNKQFRSCMLNTLFCGKSPLGDDESSSVSTSKTEVSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-500 1x 500 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF594 conjugate, 0.1mg/mL
BNC941461-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF488A conjugate, 0.1mg/mL
BNC880778-100 1x 100 µL

Cytokeratin 17 (KRT17/778), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/1198), CF647 conjugate, 0.1mg/mL
BNC471198-500 1x 500 µL

Cytokeratin 7 (KRT7/1198), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details