Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 185A (TMEM185A)

This Recombinant Human Transmembrane protein 185A (TMEM185A) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Transmembrane protein 185A, Protein FAM11A

UniProt

Q8NFB2

Expression Region

1-350

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASV GTGVWARNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMS FLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITMALSWMTIVVPLLTFEILLVHKLDGHNA FSCIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH HEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYVLPPPKLNIEMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP120 Human Gene Knockout Kit (CRISPR)
KN420841 1 Kit

CEP120 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C1orf172 (KDF1) activation kit by CRISPRa
GA114960 1 Kit

Human C1orf172 (KDF1) activation kit by CRISPRa

Sign In for Pricing
View Details
C20orf30 (TMEM230) (NM_001009925) Human Over-expression Lysate
LC423153 20 µg

C20orf30 (TMEM230) (NM_001009925) Human Over-expression Lysate

Sign In for Pricing
View Details
PRCD (NM_001077620) Human Over-expression Lysate
LC421463 20 µg

PRCD (NM_001077620) Human Over-expression Lysate

Sign In for Pricing
View Details
Progesterone Receptor (Ab-400) Antibody
8B0559-AAT 50 µg

Progesterone Receptor (Ab-400) Antibody

Sign In for Pricing
View Details
CD16 (FCGR3A) Human Recombinant Protein
TP721246 25 µg

CD16 (FCGR3A) Human Recombinant Protein

Sign In for Pricing
View Details