Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 185A (TMEM185A)

This Recombinant Human Transmembrane protein 185A (TMEM185A) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Transmembrane protein 185A, Protein FAM11A

UniProt

Q8NFB2

Expression Region

1-350

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASV GTGVWARNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMS FLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITMALSWMTIVVPLLTFEILLVHKLDGHNA FSCIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH HEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYVLPPPKLNIEMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cervix
CS705246 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Ribonuclease Inhibitor (RNH1) (NM_203386) Human Over-expression Lysate
LC404327 20 µg

Ribonuclease Inhibitor (RNH1) (NM_203386) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Cirhin (UTP4) activation kit by CRISPRa
GA113765 1 Kit

Human Cirhin (UTP4) activation kit by CRISPRa

Sign In for Pricing
View Details
NXPH3 Antibody
8C16917-AAT 50 µg

NXPH3 Antibody

Sign In for Pricing
View Details
Recombinant RPLP0 Antibody
RC-6880-01 50 μL

Recombinant RPLP0 Antibody

Sign In for Pricing
View Details
Recombinant RPLP0 Antibody
RC-6880-02 100 µL

Recombinant RPLP0 Antibody

Sign In for Pricing
View Details