Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 185A (TMEM185A)

This Recombinant Human Transmembrane protein 185A (TMEM185A) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Transmembrane protein 185A, Protein FAM11A

UniProt

Q8NFB2

Expression Region

1-350

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASV GTGVWARNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMS FLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITMALSWMTIVVPLLTFEILLVHKLDGHNA FSCIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH HEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYVLPPPKLNIEMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vrk3 Mouse Gene Knockout Kit (CRISPR)
KN519273 1 Kit

Vrk3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS711575 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF568 conjugate, 0.1mg/mL
BNC682123-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Urb1 Mouse Gene Knockout Kit (CRISPR)
KN518747 1 Kit

Urb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACE Recombinant Rabbit Monoclonal Antibody [JM59-32]
ET1705-36 100 µL

ACE Recombinant Rabbit Monoclonal Antibody [JM59-32]

Sign In for Pricing
View Details
Gastrin (GAST/2631), CF647 conjugate, 0.1mg/mL
BNC472631-100 1x 100 µL

Gastrin (GAST/2631), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details