Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit C5a anaphylatoxin chemotactic receptor (C5AR1)

This Recombinant Rabbit C5a anaphylatoxin chemotactic receptor (C5AR1) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

C5a anaphylatoxin chemotactic receptor, C5a-R, C5aR, CD_antigen= CD88

UniProt

Q9TUE1

Expression Region

1-350

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APMENSTYDYTNYDSLGTLDPSTPVDNTVRRLRPTTIVALVIYMAVFLVGVPGNALVVWV TALEAKRTVNAIWFLNLAVADLLSCLALPILFVSIIQEGHWPFGRAACSVLPSLILLNMY ASILLLATISADRFLLVFNPIWCQNTRGAGLAWLACCVAWGLALLLTIPSFLYRKVLQDD YPPKTTCGVDYGHEGVRAERAVAIVRLVVGFLLPLFTLSVCYTFLLLRTWSRNGTRSTKT LKVVVAVVVSFFIFWLPYQVMGMILALLHPSSATFRWAIRLDPLCIALAYVNCCINPIIY VVAGKGFQGQLRKSLPSLLRNVLAEESVIQGSKSFSRSTVDTVADKCQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Selectin Protein
OPRB00165-100UG 100 µg

E-Selectin Protein

Sign In for Pricing
View Details
TIMP2 CytoSection
TS409796P5 25 Slides

TIMP2 CytoSection

Sign In for Pricing
View Details
HAT1, NT (HAT1, KAT1, Histone acetyltransferase type B catalytic subunit, Histone acetyltransferase 1) (MaxLight 490)
MBS6305477-01 0.1 mL

HAT1, NT (HAT1, KAT1, Histone acetyltransferase type B catalytic subunit, Histone acetyltransferase 1) (MaxLight 490)

Sign In for Pricing
View Details
HAT1, NT (HAT1, KAT1, Histone acetyltransferase type B catalytic subunit, Histone acetyltransferase 1) (MaxLight 490)
MBS6305477-02 5x 0.1 mL

HAT1, NT (HAT1, KAT1, Histone acetyltransferase type B catalytic subunit, Histone acetyltransferase 1) (MaxLight 490)

Sign In for Pricing
View Details
Ncor2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4359603 1.0 µg DNA

Ncor2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TRAPPCL2 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2498495 100 µL

TRAPPCL2 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details