Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lysophosphatidic acid receptor 2 (LPAR2)

This Recombinant Human Lysophosphatidic acid receptor 2 (LPAR2) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Lysophosphatidic acid receptor 2, LPA receptor 2, LPA-2, Lysophosphatidic acid receptor Edg-4

UniProt

Q9HBW0

Expression Region

1-351

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HFE Rabbit Polyclonal Antibody
AP21189PU-N 100 µg

HFE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EVC2 (C-term) Goat Polyclonal Antibody
AP33367PU-N 100 µg

EVC2 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
ST13 (NM_003932) Human Recombinant Protein
TP320533L 1 mg

ST13 (NM_003932) Human Recombinant Protein

Sign In for Pricing
View Details
CMTM8 Polyclonal Antibody
E-AB-12451-01 20 µL

CMTM8 Polyclonal Antibody

Sign In for Pricing
View Details
CMTM8 Polyclonal Antibody
E-AB-12451-02 60 µL

CMTM8 Polyclonal Antibody

Sign In for Pricing
View Details
CMTM8 Polyclonal Antibody
E-AB-12451-03 120 µL

CMTM8 Polyclonal Antibody

Sign In for Pricing
View Details