Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus tantalus C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus tantalus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q95NE8

Expression Region

1-352

Origin

Cercopithecus tantalus (Tantalus monkey) (Chlorocebus tantalus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPRIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQETSVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994UT-01 25 µg

Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994UT-02 100 µg

Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
Recombinant Mouse IL-23
PKSM041374-01 10 µg

Recombinant Mouse IL-23

Sign In for Pricing
View Details
Recombinant Mouse IL-23
PKSM041374-02 50 µg

Recombinant Mouse IL-23

Sign In for Pricing
View Details
1-Benzylglycerol-2,3-carbonate
TRC-B278000-500MG 500 mg

1-Benzylglycerol-2,3-carbonate

Sign In for Pricing
View Details
Cdkn1b (NM_009875) Mouse Tagged ORF Clone
MG201957 10 µg

Cdkn1b (NM_009875) Mouse Tagged ORF Clone

Sign In for Pricing
View Details