Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus tantalus C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus tantalus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q95NE8

Expression Region

1-352

Origin

Cercopithecus tantalus (Tantalus monkey) (Chlorocebus tantalus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPRIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQETSVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Epb41l2 activation kit by CRISPRa
GA201251 1 Kit

Mouse Epb41l2 activation kit by CRISPRa

Sign In for Pricing
View Details
Twinkle (TWNK) (NM_021830) Human Over-expression Lysate
LY402882 100 µg

Twinkle (TWNK) (NM_021830) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluorobenzo[c]fluorene
TRC-F588435-10MG 10 mg

Fluorobenzo[c]fluorene

Sign In for Pricing
View Details
Human hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit
E-EL-H5134-01 24 Tests

Human hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit

Sign In for Pricing
View Details
Human hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit
E-EL-H5134-02 48 Tests

Human hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit

Sign In for Pricing
View Details
Human hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit
E-EL-H5134-03 96 Tests

Human hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit

Sign In for Pricing
View Details