Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog C5a anaphylatoxin chemotactic receptor (C5AR1)

This Recombinant Dog C5a anaphylatoxin chemotactic receptor (C5AR1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C5a anaphylatoxin chemotactic receptor, C5a-R, C5aR, CD_antigen= CD88

UniProt

P30992

Expression Region

1-352

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASMNFSPPEYPDYGTATLDPNIFVDESLNTPKLSVPDMIALVIFVMVFLVGVPGNFLVV WVTGFEVRRTINAIWFLNLAVADLLSCLALPILFSSIVQQGYWPFGNAACRILPSLILLN MYASILLLTTISADRFVLVFNPIWCQNYRGPQLAWAACSVAWAVALLLTVPSFIFRGVHT EYFPFWMTCGVDYSGVGVLVERGVAILRLLMGFLGPLVILSICYTFLLIRTWSRKATRST KTLKVVVAVVVSFFVLWLPYQVTGMMMALFYKHSESFRRVSRLDSLCVAVAYINCCINPI IYVLAAQGFHSRFLKSLPARLRQVLAEESVGRDSKSITLSTVDTPAQKSQGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-500 1x 500 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-100 1x 100 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF640R conjugate, 0.1mg/mL
BNC400898-100 1x 100 µL

GFAP (GA-5 + ASTRO/789), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD99 (MIC2/877), CF640R conjugate, 0.1mg/mL
BNC400877-100 1x 100 µL

CD99 (MIC2/877), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details