Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative permease perM (perM)

This Recombinant Putative permease perM (perM) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Putative permease perM

UniProt

P0AFJ0

Expression Region

1-353

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEMLMQWYRRRFSDPEAIALLVILVAGFGIIFFFSGLLAPLLVAIVLAYLLEWPTVRLQ SIGCSRRWATSIVLVVFVGILLLMAFVVLPIAWQQGIYLIRDMPGMLNKLSDFAATLPRR YPALMDAGIIDAMAENMRSRMLTMGDSVVKISLASLVGLLTIAVYLVLVPLMVFFLLKDK EQMLNAVRRVLPRNRGLAGQVWKEMNQQITNYIRGKVLEMIVVGIATWLGFLLFGLNYSL LLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGTEFWSCFAVYLIIQALDGNLLVPVL FSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVIHAWPDGQIAQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zscan10 (NM_001106981) Rat Tagged Lenti ORF Clone
RR215200L4 10 µg

Zscan10 (NM_001106981) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Hamster Ganglioside M1 Antibody ELISA Kit
MBS010650-01 48 Well

Hamster Ganglioside M1 Antibody ELISA Kit

Sign In for Pricing
View Details
Hamster Ganglioside M1 Antibody ELISA Kit
MBS010650-02 96 Well

Hamster Ganglioside M1 Antibody ELISA Kit

Sign In for Pricing
View Details
Hamster Ganglioside M1 Antibody ELISA Kit
MBS010650-03 5x 96 Well

Hamster Ganglioside M1 Antibody ELISA Kit

Sign In for Pricing
View Details
Hamster Ganglioside M1 Antibody ELISA Kit
MBS010650-04 10x 96 Well

Hamster Ganglioside M1 Antibody ELISA Kit

Sign In for Pricing
View Details
CRKL Protein-HIS Epitope
B2024007 20 µg

CRKL Protein-HIS Epitope

Sign In for Pricing
View Details