Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Prostaglandin D2 receptor (Ptgdr)

This Recombinant Rat Prostaglandin D2 receptor (Ptgdr) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Prostaglandin D2 receptor, PGD receptor, PGD2 receptor, Prostanoid DP receptor

UniProt

Q9R261

Expression Region

1-357

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESYRCQAATWVERGSSATMGGVAFSAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF YVLVCGLTVTDLLGKCLISPMVLAAYAQNRSLKELLPASGNQLCEAFAFLMSFFGLASTL QLLAMALECWLSLGHPFFYQRHITARRGVLVAPVAGAFSLAFCALPFAGFGKFVQYCPGT WCFIQMIHKKRSFSVIGFSVLYSSLMALLVLATVVCNLGAMSNLYAMHRRQRHHPRRCSR DRAQSGSDYRHGSPNPLEELDHFVLLALTTVLFTMCSLPLIYRAYYGAFKLVDRADGDSE DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKTFTRPLIYRNWCSHSWQTNMESTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF405S conjugate, 0.1mg/mL
BNC041227-500 1x 500 µL

Thyroglobulin (TGB04 + TGB05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF740 conjugate, 0.1mg/mL
BNC740183-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details