Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7g (Taar7g)

This Recombinant Rat Trace amine-associated receptor 7g (Taar7g) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7g, TaR-7g, Trace amine receptor 7g, Trace amine receptor 9, TaR-9

UniProt

Q923Y1

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDDGSFPWTQESILSRDLLSALSPQLCYENLNRSCVRSPYSPGSRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGDSYC KLHSCFDISFCSSSLLHLCFISVDRHIAVSDPLIYPTRFTASVSGKYITFSWLLSIIYGF SLIYTGASEAGLEDLVSALTCVGGCQVAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK QQAQNMEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFVDSIIDAFLG FITPTYVYEILAWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILKENSSTINLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF647 conjugate, 0.1mg/mL
BNC471422-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF594 conjugate, 0.1mg/mL
BNC940418-500 1x 500 µL

Fascin-1 (FSCN1/418), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details