Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Zinc transporter 2 (Slc30a2)

This Recombinant Rat Zinc transporter 2 (Slc30a2) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Zinc transporter 2, ZnT-2, Solute carrier family 30 member 2

UniProt

Q62941

Expression Region

1-359

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRSFFGALWKSEASRIPPVNLPSVELAVQSNHYCHAQKDSGSHPNSEKQRARRKLYVA SAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFSLWVSSRPATKTMNFGWQ RAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNIIMGLALH QSGHGHSHGHSHEDSSQQQQNPSVRAAFIHVVGDLLQSVGVLVAAYIIYFKPEYKYVDPI CTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTV AQPVLSVHIAIAQNVDAQAVLKVARDRLQGKFNFHTMTIQIESYSEDMKSCQECQGPSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DL-Lactic Acid (90%)
TRC-L113490-500G 500 g

DL-Lactic Acid (90%)

Sign In for Pricing
View Details
Detrityl Morpholino C Subunit Trifluoro Acetic Acid Salt
TRC-D122670-10MG 10 mg

Detrityl Morpholino C Subunit Trifluoro Acetic Acid Salt

Sign In for Pricing
View Details
Cbx7 (NM_144811) Mouse Tagged ORF Clone
MG201190 10 µg

Cbx7 (NM_144811) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Deoxycholic Acid
TRC-D232645-5G 5 g

Deoxycholic Acid

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF568 conjugate, 0.1mg/mL
BNC682682-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), 0.2mg/mL
BNUB0322-100 1x 100 µL

CD3e (RIV9), 0.2mg/mL

Sign In for Pricing
View Details