Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Zinc transporter 2 (Slc30a2)

This Recombinant Rat Zinc transporter 2 (Slc30a2) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Zinc transporter 2, ZnT-2, Solute carrier family 30 member 2

UniProt

Q62941

Expression Region

1-359

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRSFFGALWKSEASRIPPVNLPSVELAVQSNHYCHAQKDSGSHPNSEKQRARRKLYVA SAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFSLWVSSRPATKTMNFGWQ RAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNIIMGLALH QSGHGHSHGHSHEDSSQQQQNPSVRAAFIHVVGDLLQSVGVLVAAYIIYFKPEYKYVDPI CTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTV AQPVLSVHIAIAQNVDAQAVLKVARDRLQGKFNFHTMTIQIESYSEDMKSCQECQGPSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD44 Antibody
RD22260F-01 25 µg

Purified Anti-Human CD44 Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD44 Antibody
RD22260F-02 100 µg

Purified Anti-Human CD44 Antibody

Sign In for Pricing
View Details
Mono-2-ethyl-5-carboxypentyl Terephthalate-d4 (MECPTP)
TRC-M525632-1MG 1 mg

Mono-2-ethyl-5-carboxypentyl Terephthalate-d4 (MECPTP)

Sign In for Pricing
View Details
YAP1 (C-term) Rabbit Polyclonal Antibody
AP17844PU-N 400 µL

YAP1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cardanol (Mixture) (>80%)
TRC-C183383-50G 50 g

Cardanol (Mixture) (>80%)

Sign In for Pricing
View Details
Rrm1 Mouse Gene Knockout Kit (CRISPR)
KN515138 1 Kit

Rrm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details