Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Zinc transporter 2 (Slc30a2)

This Recombinant Rat Zinc transporter 2 (Slc30a2) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Zinc transporter 2, ZnT-2, Solute carrier family 30 member 2

UniProt

Q62941

Expression Region

1-359

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRSFFGALWKSEASRIPPVNLPSVELAVQSNHYCHAQKDSGSHPNSEKQRARRKLYVA SAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFSLWVSSRPATKTMNFGWQ RAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNIIMGLALH QSGHGHSHGHSHEDSSQQQQNPSVRAAFIHVVGDLLQSVGVLVAAYIIYFKPEYKYVDPI CTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTV AQPVLSVHIAIAQNVDAQAVLKVARDRLQGKFNFHTMTIQIESYSEDMKSCQECQGPSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF5 (NM_006913) Human Over-expression Lysate
LY402057 100 µg

RNF5 (NM_006913) Human Over-expression Lysate

Sign In for Pricing
View Details
RPS6 Rabbit Polyclonal Antibody
AP06578PU-N 100 µg

RPS6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Transfer Pipettes
P4123-11 500 Units/Case

Transfer Pipettes

Sign In for Pricing
View Details
Clopyralid d2
TRC-C587354-100MG 100 mg

Clopyralid d2

Sign In for Pricing
View Details
Human PCP4 activation kit by CRISPRa
GA103422 1 Kit

Human PCP4 activation kit by CRISPRa

Sign In for Pricing
View Details
Dopamine Transporter Recombinant Chimeric Antibody Antibody
HA610309 100 µg

Dopamine Transporter Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details