Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukotriene B4 receptor 2 (Ltb4r2)

This Recombinant Mouse Leukotriene B4 receptor 2 (Ltb4r2) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Leukotriene B4 receptor 2, LTB4-R 2, LTB4-R2, Leukotriene B4 receptor BLT2

UniProt

Q9JJL9

Expression Region

1-360

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVCYRPPGNETLLSWKGSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPTAGRPLAATL VLHLALADGAVLLLTPLFVAFLSQEAWPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRC LAVTRPFLAPRLRSPALARRLLLGVWLAALVLAVPAAVYRHLWGGRVCQLCHPSPVHAAA HLSLETLTAFVLPFGTVLGCYGVTLARLRGARWGSGRQGTRVGRLVSAIVLAFGLLWAPY HAVNLLQAVAALAPPEGPLARLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG PRFLTRLFEGSGEARGGSRSREGTMELRTTPKLKVMGQGRGNGDPGGGDGGKTEKDSQEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transketolase Like Protein 1 (TKTL1) ELISA Kit
DLR-TKTL1-Hu-96T 96 Tests

Human Transketolase Like Protein 1 (TKTL1) ELISA Kit

Sign In for Pricing
View Details
Donkey Opacity-Associated Proteins ELISA Kit
MBS055685 Inquire

Donkey Opacity-Associated Proteins ELISA Kit

Sign In for Pricing
View Details
Lentiviral human DLEC1 sgRNA gene knockout kit - Lentiviral human DLEC1 sgRNA gene knockout kit (plasmid)
GTR15377963 1 Vial

Lentiviral human DLEC1 sgRNA gene knockout kit - Lentiviral human DLEC1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Olr242 (NM_001000213) Rat Tagged ORF Clone Lentiviral Particle
RR210123L3V 200 µL

Olr242 (NM_001000213) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Thymidylate Synthase Antibody Cocktail
V3164SAF-100UG 100 µg

Thymidylate Synthase Antibody Cocktail

Sign In for Pricing
View Details
Mouse Monoclonal mediator of cell motility 1 Antibody (1E9) [Alexa Fluor 594]
NBP2-22593AF594 0.1 mL

Mouse Monoclonal mediator of cell motility 1 Antibody (1E9) [Alexa Fluor 594]

Sign In for Pricing
View Details