Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukotriene B4 receptor 2 (Ltb4r2)

This Recombinant Mouse Leukotriene B4 receptor 2 (Ltb4r2) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Leukotriene B4 receptor 2, LTB4-R 2, LTB4-R2, Leukotriene B4 receptor BLT2

UniProt

Q9JJL9

Expression Region

1-360

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVCYRPPGNETLLSWKGSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPTAGRPLAATL VLHLALADGAVLLLTPLFVAFLSQEAWPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRC LAVTRPFLAPRLRSPALARRLLLGVWLAALVLAVPAAVYRHLWGGRVCQLCHPSPVHAAA HLSLETLTAFVLPFGTVLGCYGVTLARLRGARWGSGRQGTRVGRLVSAIVLAFGLLWAPY HAVNLLQAVAALAPPEGPLARLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG PRFLTRLFEGSGEARGGSRSREGTMELRTTPKLKVMGQGRGNGDPGGGDGGKTEKDSQEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS33 Polyclonal Antibody
MBS2573682-01 0.06 mL

MRPS33 Polyclonal Antibody

Sign In for Pricing
View Details
MRPS33 Polyclonal Antibody
MBS2573682-02 0.12 mL

MRPS33 Polyclonal Antibody

Sign In for Pricing
View Details
MRPS33 Polyclonal Antibody
MBS2573682-03 0.2 mL

MRPS33 Polyclonal Antibody

Sign In for Pricing
View Details
MRPS33 Polyclonal Antibody
MBS2573682-04 5x 0.2 mL

MRPS33 Polyclonal Antibody

Sign In for Pricing
View Details
Cltb (NM_028870) Mouse Tagged Lenti ORF Clone
MR215667L3 10 µg

Cltb (NM_028870) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Rhesus Macaque SSR3 Protein, His (Fc)-Avi-tagged
SSR3-4307R 50 µg

Recombinant Rhesus Macaque SSR3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details