Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-37 (sre-37)

This Recombinant Serpentine receptor class epsilon-37 (sre-37) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-37, Protein sre-37

UniProt

O17818

Expression Region

1-362

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVIYLNSTGNTYWIPIYSLNDKIREPYIFYVFAIFQTSIYILTGYILVRICWIFLTIKV FHDNMNIMMCWFLCQWFQAFLAKIVLIPYQFGIIKISMDINKTYYDWWSDTVEKSAILRE DVNIWPIYFASYFLWHYMYSILFAVLAVGLERVCATWYIQDYEHVSRRHIPILLIAATNL ITLPYAYQTTNNRTPLLQTCLQSIFIGSVAVFGYIMLWRVNLAWRNRIVNLKFTHNEKYS LARKFQIEENIKSLILARKLVVSASVFILVVTILLAVLLFDPHGYDAFFVHALDNSMLLP ALVMSLTLLSCSPAWKERFISGLPIIRRLKSSSVAHQNSYSTASSAGKETEAYFEQLRSS WA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitofilin Recombinant Rabbit Monoclonal Antibody [PSH01-19]
HA721636 100 µL

Mitofilin Recombinant Rabbit Monoclonal Antibody [PSH01-19]

Sign In for Pricing
View Details
USP10 Recombinant Rabbit Monoclonal Antibody [JU32-62]
ET1706-12 100 µL

USP10 Recombinant Rabbit Monoclonal Antibody [JU32-62]

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF568 conjugate, 0.1mg/mL
BNC682958-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CIRBP (81-91) Goat Polyclonal Antibody
AP21511PU-N 100 µg

CIRBP (81-91) Goat Polyclonal Antibody

Sign In for Pricing
View Details
2-Adamantanamine Hydrochloride
TRC-A575843-10MG 10 mg

2-Adamantanamine Hydrochloride

Sign In for Pricing
View Details
(E)-Guggulsterone
TRC-G852005-10MG 10 mg

(E)-Guggulsterone

Sign In for Pricing
View Details